PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00012.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 269aa    MW: 31249.5 Da    PI: 6.8772
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00012.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.3e-5471321128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+v+yLk+++ ++++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra+ sgyWkat
  Rsa1.0_00012.1_g00005.1   7 LPPGFRFHPTDEELIVYYLKNQTMSRPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRDRKYPNGVRPNRAAVSGYWKAT 91 
                              79****************************.89***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+++s ++ +vg+kk Lvfykgr pkg ktdW+mheyrl
  Rsa1.0_00012.1_g00005.1  92 GTDKAIYS-GSCNVGVKKALVFYKGRPPKGIKTDWIMHEYRL 132
                              ********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-655159IPR003441NAC domain
PROSITE profilePS5100560.5757159IPR003441NAC domain
PfamPF023651.3E-268132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MNPNTALPPG FRFHPTDEEL IVYYLKNQTM SRPCPVSIIP EVDIYKFDPW QLPEKTEFGE  60
NEWYFFSPRD RKYPNGVRPN RAAVSGYWKA TGTDKAIYSG SCNVGVKKAL VFYKGRPPKG  120
IKTDWIMHEY RLNDSRKAST KRNGSMRLDE WVLCRIYKKR LGAGKLLDER EGYMDEVQTD  180
ETLTVVTNEV ERRNEEEITM MTSTKLPRTC SLAHLLEMDY MGPISHILTP FDLHSPDPNI  240
ANESGWFGDL QINQDEILNH HRQASMFQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-70616519174NAC domain-containing protein 19
3swm_B1e-70616519174NAC domain-containing protein 19
3swm_C1e-70616519174NAC domain-containing protein 19
3swm_D1e-70616519174NAC domain-containing protein 19
3swp_A1e-70616519174NAC domain-containing protein 19
3swp_B1e-70616519174NAC domain-containing protein 19
3swp_C1e-70616519174NAC domain-containing protein 19
3swp_D1e-70616519174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667500.0KC966750.1 Brassica napus NAC transcription factor 29 (NAC29.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105493.10.0PREDICTED: NAC transcription factor 29
RefseqNP_001302976.10.0NAC transcription factor 29-like
SwissprotO492551e-168NAC29_ARATH; NAC transcription factor 29
TrEMBLA0A078HQP60.0A0A078HQP6_BRANA; BnaC06g30680D protein
STRINGBra004385.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77072641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-160NAC-like, activated by AP3/PI